Invitrogen™ Human CD21 (aa 142-240) Control Fragment Recombinant Protein

Product Code. 30209281

Brand: Invitrogen™ RP103141

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84131 (PA5-84131. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD21 (complement receptor 2, CR2, C3D receptor, EBV receptor) binds C3 complement fragments, especially its breakdown fragments, which remain covalently attached to complement activating surfaces or antigen. CD21 has important roles in uptake and retention of immunocomplexes, survival of memory B cells and in development and maintenance of the humoral response to T-dependent antigens. CD21 also serves as a key receptor for Epstein-Barr virus binding and is involved in targeting prions to follicular dendritic cells and expediting neuroinvasion following peripheral exposure to prions. A soluble form of the CD21 (sCD21) is shed from the lymphocyte surface and retains its ability to bind respective ligands. CD21 functions as receptor for C3d, C3dg and iC3b complement components, for EBV and for IFNalpha. CD21 binds to CD23 and associates with CD19, CD81 and Leu13 to form a large signal-transduction complex involved in B cell activation. Genetic variations in the CD21 gene are associated with susceptibility to systemic lupus erythematosus type 9 (SLEB9). Alternatively, spliced transcript variants encoding different isoforms of CD21 have been found.

Specifications

• Accession Number: P20023
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1380
• Name: Human CD21 (aa 142-240) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C3b/C4b receptor; C3-binding protein; C3BR; C3DR; C4BR; CD21; CD35; CD35 antigen; cell surface receptor for C3d; complement C3b/C4b receptor 1 (Knops blood group); complement C3d receptor; Complement C3d receptor (C3DR); complement C3d receptor 2; complement component (3 b/4 b) receptor 1 (Knops blood group); complement component (3 d/Epstein Barr virus) receptor 2; complement component 3 b/4 b receptor 1 (Knops blood group); complement component 3 d receptor 2; complement component receptor 2; complement receptor 1 long isoform; complement receptor 2; complement receptor type 1; complement receptor type 1-like protein; complement receptor type 2; Complement Receptor type 2 (CR2); CR; CR1; Cr-1; CR1-L; Cr2; Cr-2; CVID7; EBV receptor; EBV-R; Epstein-Barr virus receptor; EVBR; expressed in B lymphocytes; KN; Knops blood group antigen; LOW QUALITY PROTEIN: complement receptor type 1; SLEB9
• Common Name: CD21
• Gene Symbol: CR2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVTYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVTANF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining