Invitrogen™ Human CD204 (aa 77-197) Control Fragment Recombinant Protein

Product Code. 30210514

Brand: Invitrogen™ RP93669

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81867 (PA5-81867. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD204 gene encodes the class A macrophage scavenger receptors, which include three different types (1, 2, 3) generated by alternative splicing of this gene. These receptors or isoforms are macrophage-specific trimeric integral membrane glycoproteins and have been implicated in many macrophage-associated physiological and pathological processes including atherosclerosis, Alzheimer's disease, and host defense. The isoforms type 1 and type 2 are functional receptors and are able to mediate the endocytosis of modified low density lipoproteins (LDLs). The isoform type 3 does not internalize modified LDL (acetyl-LDL) despite having the domain shown to mediate this function in the types 1 and 2 isoforms. It has an altered intracellular processing and is trapped within the endoplasmic reticulum, making it unable to perform endocytosis. The isoform type 3 can inhibit the function of isoforms type 1 and type 2 when co-expressed, indicating a dominant negative effect and suggesting a mechanism for regulation of scavenger receptor activity in macrophages. Diseases associated with MSR1 include Barrett Esophagus and Prostate Cancer.

Specifications

• Accession Number: P21757
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4481
• Name: Human CD204 (aa 77-197) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: bovine scavenger receptor type II; CD204; Macrophage acetylated LDL receptor I and II; macrophage scavenger receptor 1; macrophage scavenger receptor type III; macrophage scavenger receptor types I and II; MRS-A; MSR; Msr1; MSR-A; phSR1; phSR2; RGD1564316; SCARA1; Scavenger receptor class A member 1; scavenger receptor class A, member 1; scavenger receptor type A; scavenger receptor type I; Scvr; SRA; SR-A; SR-AI; SR-AI/II; SR-AII
• Common Name: CD204
• Gene Symbol: MSR1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining