Invitrogen™ Human CD1e (aa 153-211) Control Fragment Recombinant Protein

Code produit. 30198926

missing translation for 'mfr': Invitrogen™ RP110209

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (42%), Rat (42%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144988 (PA5-144988. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD1E encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes within Golgi compartments, endosomes, and lysosomes, and is cleaved into a stable soluble form. The soluble form is required for the intracellular processing of some glycolipids into a form that can be presented by other CD1 family members.

Spécification

• Accession Number: P15812
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 913
• Name: Human CD1e (aa 153-211) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CD1A; CD1e; CD1E antigen, e polypeptide; CD1e molecule; differentiation antigen CD1-alpha-3; hCD1e; leukocyte differentiation antigen; R2; R2G1; sCD1e; T-cell surface glycoprotein CD1e, membrane-associated; T-cell surface glycoprotein CD1e, soluble; thymocyte antigen CD1E
• Common Name: CD1e
• Gene Symbol: CD1E
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVKP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining