Invitrogen™ Human CD18 (aa 25-140) Control Fragment Recombinant Protein

Product Code. 30209603

Brand: Invitrogen™ RP88640

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82368 (PA5-82368. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD18 integrin beta 2 subunit is a 90 kDa type I transmembrane protein expressed on all leucocytes. CD18 can combine with integrin molecules CD11a-c to form heterodimers at the cell surface, and these heterodimers are known to participate in the process of cell adhesion as well as cell-surface mediated signaling. CD18 forms heterodimers with four types of CD11 molecule to constitute leukocyte (beta2) integrins: alphaLbeta2 (CD11a/CD18, LFA-1), alphaMbeta2 (CD11b/CD18, Mac-1, CR3), alphaXbeta2 (CD11c/CD18) and alphaDbeta2 (CD11d/CD18). In most cases, the response mediated by the integrin is a composite of the functions of its individual subunits, and these integrins are essential for proper leukocyte migration, mediating intercellular contacts. Absence of CD18 leads to leukocyte adhesion deficiency-1, severe reduction of CD18 expression leads to the development of a psoriasiform skin disease. CD18 is also a target of Mannheimia (Pasteurella) haemolytica leukotoxin and is sufficient to mediate leukotoxin-mediated cytolysis. Defects in the CD18 gene are the cause of leukocyte adhesion deficiency type I (LAD1). Two transcript variants encoding the CD18 protein have been identified.

Specifications

• Accession Number: P05107
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3689
• Name: Human CD18 (aa 25-140) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2E6; AI528527; antigen CD18; B-2 integrin; CD18; CD18 leukocyte adhesion molecule; CD18 subunit; cell surface adhesion glycoprotein (LFA-1/CR3/P150,959 beta subunit precursor); cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta; complement component 3 receptor 3 and 4 subunit; complement receptor C3 beta-subunit; complement receptor C3 subunit beta; integrin beta 2; integrin beta chain, beta 2; integrin beta-2; integrin subunit beta 2; integrin, beta 2; integrin, beta 2 (antigen CD18 (p95), lymphocyte function-associated antigen 1; integrin, beta 2 (antigen CD18 (p95), lymphocyte function-associated antigen 1; macrophage antigen 1 (mac-1) beta subunit); integrin, beta 2 (antigen CD18 subunit (p95), lymphocyte function-associated antigen 1, integrin B2); integrin, beta 2 (complement component 3 receptor 3 and 4 subunit); ITGB2; LAD; LCAMB; Leu-CAM receptor; leukocyte cell adhesion molecule CD18; leukocyte surface protein; leukocyte-associated antigens CD18/11 A, CD18/11 B, CD18/11 C; Lfa1; LFA-1; lymphocyte function associated antigen 1; MAC-1; Mac-1 beta; macrophage antigen 1 (mac-1) beta subunit); macrophage antigen-1 beta; MF17; MFI7
• Common Name: CD18
• Gene Symbol: ITGB2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining