missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CD179a (aa 20-138) Control Fragment Recombinant Protein

Product Code. 30198573
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198573

Brand: Invitrogen™ RP91363

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63199 (PA5-63199. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the immunoglobulin superfamily and is expressed selectively at the early stages of B cell development, namely, in proB and early preB cells. This gene encodes the iota polypeptide chain that is associated with the Ig-mu chain to form a molecular complex which is expressed on the surface of pre-B cells. The complex is thought to regulate Ig gene rearrangements in the early steps of B-cell differentiation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P12018
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7441
Name Human CD179a (aa 20-138) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CD179 antigen-like family member A; CD179a; IGI; IGLL1; IGVPB; Immunoglobulin iota chain; Immunoglobulin lambda Vpreb1 chain; immunoglobulin lambda-1 light chain; immunoglobulin lambda-like polypeptide 5; LOC100735142; pre-B lymphocyte 1; pre-B lymphocyte gene 1; Protein VPreB1; surrogate light chain; v(pre)B protein; VPREB; VpreB protein; Vpreb1; Vpreb-1; V-set pre-B cell surrogate light chain 1
Common Name CD179a
Gene Symbol VPREB1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis