missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CD155 (aa 130-209) Control Fragment Recombinant Protein

Product Code. 30213348
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213348

Brand: Invitrogen™ RP109068

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication. Multiple transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P15151
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5817
Name Human CD155 (aa 130-209) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3830421F03Rik; AI325026; AI987993; CD112; CD155; D7Ertd458e; FLJ25946; herpes virus entry mediator B; Herpesvirus entry mediator B; hveB; HVED; mE4; mHveB; Mph; murine herpes virus entry protein B; murine herpesvirus entry protein B; NECL5; necl-5; Nectin cell adhesion molecule 2; Nectin2; Nectin-2; nectin-like 5; nectin-like protein 5; Poliovirus receptor; poliovirus receptor homolog; poliovirus receptor-related 2; poliovirus receptor-related protein 2; poliovirus sensitivity; PVR; Pvrl2; PVS; sCD112; soluble CD112; Taa1; TAGE4; tumor-associated antigen 1; tumor-associated glycoprotein pE4
Common Name CD155
Gene Symbol PVR
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.