Invitrogen™ Human CD11c (aa 596-705) Control Fragment Recombinant Protein

Product Code. 30209680

Brand: Invitrogen™ RP88636

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110685 (PA5-110685. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD11, along with CD18, form a heterodimer adhesion molecule. In particular, CD11 is composed of CD11a, CD11b and CD11c. CD11a is a leukocyte marker that is expressed in B and T lymphocytes, macrophages, monocytes, neutrophils, basophils and eosinophils. CD11b is primarily expressed by monocytes, macrophages, natural killer cells, some B and T-cells, and granulocytes. CD11c is expressed in monocytes, macrophages, natural killer cells, some granulocytes and less so in a subset of lymphocytes.

Specifications

• Accession Number: P20702
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3687
• Name: Human CD11c (aa 596-705) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI449405; CD11 antigen-like family member C; CD11c; CD11C (p150) alpha polypeptide; complement component 3 receptor 4 subunit; complement receptor 4; Cr4; integrin alpha X; integrin alpha-X; integrin aX; integrin subunit alpha X; integrin, alpha X; integrin, alpha x (antigen CD11C (p150), alpha polypeptide); integrin, alpha x (complement component 3 receptor 4 subunit); Itgax; Leu M5; leu M5, alpha subunit; leukocyte adhesion glycoprotein p150,95 alpha chain; Leukocyte adhesion receptor p150,95; leukocyte surface antigen p150,95, alpha subunit; myeloid membrane antigen, alpha subunit; N418; p150 95 integrin alpha chain; RGD1561123; SLEB6
• Common Name: CD11c
• Gene Symbol: Itgax
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining