Invitrogen™ Human CCRD6 (aa 321-384) Control Fragment Recombinant Protein

Product Code. 30204419

Brand: Invitrogen™ RP90800

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110787 (PA5-110787. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a beta chemokine receptor, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptor-mediated signal transduction are critical for the recruitment of effector immune cells to the inflammation site. This gene is expressed in a range of tissues and hemopoietic cells. The expression of this receptor in lymphatic endothelial cells and overexpression in vascular tumors suggested its function in chemokine-driven recirculation of leukocytes and possible chemokine effects on the development and growth of vascular tumors. This receptor appears to bind the majority of beta-chemokine family members; however, its specific function remains unknown. This gene is mapped to chromosome 3p21.3, a region that includes a cluster of chemokine receptor genes.

Specifications

• Accession Number: O00590
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1238
• Name: Human CCRD6 (aa 321-384) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Ackr2; AI464239; Atypical chemokine receptor 2; C-C chemokine receptor D6; Ccbp2; CC-chemokine-binding receptor JAB61; CCR10; CCR10-related receptor; CCR9; chemokine (C-C motif) receptor 9; chemokine (C-C) receptor 9; chemokine binding protein 2; chemokine decoy receptor D6; chemokine receptor CCR-10; Chemokine receptor CCR-9; chemokine receptor D6; chemokine-binding protein 2; Chemokine-binding protein D6; CMKBR9; D6; D6 beta-chemokine receptor; hD6
• Common Name: CCRD6
• Gene Symbol: ACKR2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining