Invitrogen™ Human CCP3 Control Fragment Recombinant Protein

Product Code. 30209717

Brand: Invitrogen™ RP92759

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54196 (PA5-54196. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Metallocarboxypeptidase that mediates both deglutamylation and deaspartylation of target proteins. Catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins. Also removes gene-encoded polyglutamates or polyaspartates from the carboxy-terminus of target proteins such as MYLK. Does not show detyrosinase or deglycylase activities from the carboxy-terminus of tubulin. [UniProt]

Specifications

• Accession Number: Q8NEM8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 340351
• Name: Human CCP3 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900053G10Rik; 4930431N21Rik; 6530406M24Rik; Agbl3; ATP/GTP binding protein like 3; ATP/GTP binding protein-like 3; ATP/GTP-binding protein-like 3; CBCP3; CCP3; Cytosolic carboxypeptidase 3; RGD1561995
• Common Name: CCP3
• Gene Symbol: Agbl3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CPEPVYIPTGLETQPLYPDSKEATVVYLAEDAYKEPCFVYSRVGGNRTPLKQPVDYRDNTLMFEARFESGNLQKVVKVAEYEY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining