Invitrogen™ Human CCNDBP1 (aa 143-230) Control Fragment Recombinant Protein

Product Code. 30210594

Brand: Invitrogen™ RP104728

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65285 (PA5-65285. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D. Transfection of this gene in cells was reported to reduce the phosphorylation of Rb gene product by cyclin D-dependent protein kinase, and inhibit E2F1-mediated transcription activity. This protein was also found to interact with helix-loop-helix protein E12 and is thought to be a negative regulator of liver-specific gene expression. Two alternatively spliced variants, which encode distinct isoforms, have been reported.

Specifications

• Accession Number: O95273
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23582
• Name: Human CCNDBP1 (aa 143-230) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AU022347; Ccndbp1; cyclin D1 binding protein 1; cyclin D-type binding-protein 1; cyclin-D1-binding protein 1; DIP1; D-type cyclin-interacting protein 1; GCIP; grap2 and cyclin D interacting protein; grap2 and cyclin-D-interacting protein; HHM; human homolog of Maid; Maid; Maternal Id-like protein; maternal inhibition of differentiation; SECC-8; SSEC-8; Stage specific embryonic cDNA-8 protein
• Common Name: CCNDBP1
• Gene Symbol: CCNDBP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSNQD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining