Invitrogen™ Human CCDC89 (aa 19-108) Control Fragment Recombinant Protein

Product Code. 30204432

Brand: Invitrogen™ RP104722

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65274 (PA5-65274. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CCDC89 is a protein coding gene.

Specifications

• Accession Number: Q8N998
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 220388
• Name: Human CCDC89 (aa 19-108) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700019B01Rik; AU022100; bc8 orange-interacting protein; bc8 orange-interacting protein {ECO:0000303; BOIP; ccdc89; ccdc89 {ECO:0000312; coiled-coil domain containing 89; coiled-coil domain-containing protein 89; coiled-coil domain-containing protein 89 {ECO:0000312; ECO:0000312; EMBL:AAI67063.1, ECO:0000312; EMBL:AAI670631; PubMed:14648848}; RGD:1305335}; RGD1305335; zgc:172182
• Common Name: CCDC89
• Gene Symbol: CCDC89
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PEERLEKQNEKLNNQEEETEFKELDGLREALANLRGLSEEERSEKAMLRSRIEEQSQLICILKRRSDEALERCQILELLNAELEEKMMQE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining