Invitrogen™ Human CCDC86 (aa 72-157) Control Fragment Recombinant Protein

Product Code. 30210394

Brand: Invitrogen™ RP97314

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59617 (PA5-59617. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Coiled-coil domain-containing protein 86 (CCDC86) was identified as an immediate-early cytokine-responsive gene induced by interleukin 3 (IL-3) in a hematopoietic cell line. CCDC86 contains a coiled-coil domain in the C-terminus.

Specifications

• Accession Number: Q9H6F5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79080
• Name: Human CCDC86 (aa 72-157) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933411H20Rik; 6720480F16Rik; CCDC86; coiled-coil domain containing 86; coiled-coil domain-containing protein 86; CYCLON; cytokine-induced protein with coiled-coil domain; D19Ertd678e; hypothetical protein LOC540913; mCyclon; MGC2574; MNCb-4327
• Common Name: CCDC86
• Gene Symbol: CCDC86
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LQQGAGLESPQGQPEPGAASPQRQQDLHLESPQRQPEYSPESPRCQPKPSEEAPKCSQDQGVLASELAQNKEELTPGAPQHQLPPV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining