Invitrogen™ Human CCDC62 (aa 490-594) Control Fragment Recombinant Protein

Product Code. 30182285

Brand: Invitrogen™ RP97747

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63609 (PA5-63609. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nuclear receptor coactivator that can enhance preferentially estrogen receptors ESR1 and ESR2 transactivation. Modulates also progesterone/PGR, glucocorticoid/NR3C1 and androgen/AR receptors transactivation, although at lower level; little effect on vitamin D receptor/VDR. [UniProt]

Specifications

• Accession Number: Q6P9F0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84660
• Name: Human CCDC62 (aa 490-594) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: aaa-protein; AI661708; cancer/testis antigen 109; Ccdc62; coiled-coil domain containing 62; coiled-coil domain-containing protein 60; coiled-coil domain-containing protein 62; CT109; ERAP75; Gm150; Protein aaa; Protein TSP-NY; testis-specific protein TSP-NY; TSP-NY
• Common Name: CCDC62
• Gene Symbol: CCDC62
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MERSEISCCQKNEACLGESGMCDSKCCHPSNFIIEAPGHMSDVEWMSIFKPSKMQRIVRLKSGCTCSESICGTQHDSPASELIAIQDSHSLGSSKSALREDETES
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining