Invitrogen™ Human CCDC6 (aa 117-200) Control Fragment Recombinant Protein

Product Code. 30206475

Brand: Invitrogen™ RP92555

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53905 (PA5-53905. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.

Specifications

• Accession Number: Q16204
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8030
• Name: Human CCDC6 (aa 117-200) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810012H18Rik; AA536681; AA960498; AW061011; CCDC6; coiled-coil domain containing 6; coiled-coil domain-containing protein 6; D10S170; H4; Papillary thyroid carcinoma-encoded protein; Protein H4; PTC; TPC; TST1
• Common Name: CCDC6
• Gene Symbol: CCDC6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FKKIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining