Invitrogen™ Human CCDC53 (aa 88-190) Control Fragment Recombinant Protein

Product Code. 30203652

Brand: Invitrogen™ RP102826

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58349 (PA5-58349. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acts as a component of the WASH core complex that functions as a nucleation-promoting factor (NPF) at the surface of endosomes, where it recruits and activates the Arp2/3 complex to induce actin polymerization, playing a key role in the fission of tubules that serve as transport intermediates during endosome sorting. [UniProt]

Specifications

• Accession Number: Q9Y3C0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51019
• Name: Human CCDC53 (aa 88-190) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900091E11Rik; 5730495F03Rik; AD-016; Ccdc53; CGI-116; coiled-coil domain containing 53; coiled-coil domain-containing protein 53; RGD1563761; WASH complex subunit 3; WASH complex subunit CCDC53; WASHC3; x0009
• Common Name: CCDC53
• Gene Symbol: WASHC3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PLNVTSVTNGAHPEATSEQPQQNSTQDSGLQESEVSAENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSES
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining