Invitrogen™ Human CCDC48 (aa 438-511) Control Fragment Recombinant Protein

Product Code. 30209862

Brand: Invitrogen™ RP100120

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62261 (PA5-62261. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of this protein remains unknown.

Specifications

• Accession Number: Q9HA90
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79825
• Name: Human CCDC48 (aa 438-511) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C3orf73; Ccdc48; Ccdc48l1; coiled-coil domain containing 48; coiled-coil domain containing 48 like; coiled-coil domain containing 48-like1; coiled-coil domain-containing protein 48; EFCC1; EF-hand and coiled-coil domain containing 1; EF-hand and coiled-coil domain-containing protein 1; EF-hand domain-containing protein ENSP00000381169; EF-hand domain-containing protein ENSP00000381169 homolog
• Common Name: CCDC48
• Gene Symbol: EFCC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MTYFGHFGGANHAHTLGELEACIAMLVEQLRTQGCGGRTLGTSEEEAELQQKVEENEHLRLELQMVETERVRLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining