Invitrogen™ Human CCDC34 (aa 92-191) Control Fragment Recombinant Protein

Product Code. 30206477

Brand: Invitrogen™ RP97278

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58016 (PA5-58016. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CCDC34 (Coiled-Coil Domain Containing 34) is a Protein Coding gene. Involved in spermatogenesis. Has a probable role in anterograde intraflagellar transport which is essential for the formation of sperm flagella.

Specifications

• Accession Number: Q96HJ3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 91057
• Name: Human CCDC34 (aa 92-191) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810027O19Rik; 4930522P10Rik; AI596202; CCDC34; coiled-coil domain containing 34; coiled-coil domain-containing protein 34; L15; NY-REN-41; NY-REN-41 antigen; RAMA3; Renal carcinoma antigen NY-REN-41; RGD1560583
• Common Name: CCDC34
• Gene Symbol: CCDC34
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DEEDVDEDAHDSEAKVASLRGMELQGCASTQVESENNQEEQKQVRLPESRLTPWEVWFIGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAEEK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining