Invitrogen™ Human CCDC19 (aa 135-217) Control Fragment Recombinant Protein

Product Code. 30182101

Brand: Invitrogen™ RP99841

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60439 (PA5-60439. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function remains unknown.

Specifications

• Accession Number: Q9UL16
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25790
• Name: Human CCDC19 (aa 135-217) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700028D05Rik; CCDC19; CFAP45; cilia and flagella associated protein 45; cilia- and flagella-associated protein 45; coiled-coil domain containing 19; Coiled-coil domain-containing protein 19; coiled-coil domain-containing protein 19, mitochondrial; nasopharyngeal epithelium specific protein 1; nasopharyngeal epithelium specific protein 1 (NESG1); nasopharyngeal epithelium-specific protein 1; NESG1; protein CFAP45, mitochondrial; Unknown (protein for MGC:134208)
• Common Name: CCDC19
• Gene Symbol: CFAP45
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KEATMDAVMTRKKIMKQKEMVWNNNKKLSDLEEVAKERAQNLLQRANKLRMEQEEELKDMSKIILNAKCHAIRDAQILEKQQI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining