Invitrogen™ Human CCDC182 (aa 77-153) Control Fragment Recombinant Protein

Product Code. 30205665

Brand: Invitrogen™ RP93363

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54801 (PA5-54801. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CCDC182 (Coiled-Coil Domain Containing 182) is a Protein Coding gene. Diseases associated with CCDC182 include Epithelial Recurrent Erosion Dystrophy. [GeneCards]

Specifications

• Accession Number: A6NF36
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 101927581
• Name: Human CCDC182 (aa 77-153) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CCDC182; coiled-coil domain containing 182; coiled-coil domain-containing protein 182; coiled-coil domain-containing protein ENSP00000299415
• Common Name: CCDC182
• Gene Symbol: CCDC182
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EDAFCEMNGALVQQEEQAARVRQRLREEEDRGIVRNKVLTFLLPREKQLREHCKRLEDLLLDRGRDALRATKKSQAD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining