Invitrogen™ Human CCDC181 (aa 225-314) Control Fragment Recombinant Protein

Product Code. 30211377

Brand: Invitrogen™ RP94122

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55564 (PA5-55564. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q5TID7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57821
• Name: Human CCDC181 (aa 225-314) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930455F23Rik; AI427889; C1orf114; Ccdc181; coiled-coil domain containing 181; coiled-coil domain-containing protein 181; RGD1309708
• Common Name: CCDC181
• Gene Symbol: CCDC181
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FELLNLQDIASQGFLPPINNANSTENDPQQLLPRSSNSSVSGTKKEDSTAKIHAVTHSSTGEPLAYIAQPPLNRKTCPSSAVNSDRSKGN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining