Invitrogen™ Human CCDC146 (aa 698-814) Control Fragment Recombinant Protein

Product Code. 30210590

Brand: Invitrogen™ RP92722

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54149 (PA5-54149. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function ofCCDC146 remains unknown.

Specifications

• Accession Number: Q8IYE0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57639
• Name: Human CCDC146 (aa 698-814) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930528G09Rik; Ccdc146; coiled-coil domain containing 146; coiled-coil domain-containing protein 146; KIAA1505; mKIAA1505
• Common Name: CCDC146
• Gene Symbol: CCDC146
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLLPAKRSLDADLAVLQIQFSQCTDRIKDLEKQFVKPDGENRARFLPGKDLTEKEMIQKLDKLELQLAKKEEKLLEKDFIYEQVSRLTDRLCSKTQGCKQDTLLLAKKMNGYQRRIK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining