Invitrogen™ Human CCDC132 (aa 491-605) Control Fragment Recombinant Protein

Product Code. 30197428

Brand: Invitrogen™ RP92587

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55374 (PA5-55374. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CCDC132 is a protein coding gene.

Specifications

• Accession Number: Q96JG6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55610
• Name: Human CCDC132 (aa 491-605) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700034M03Rik; 8430415E05Rik; Bcl2-like protein blm; BLM; C87205; CCDC132; coiled-coil domain containing 132; coiled-coil domain-containing protein 132; DKFZp313I2429; EARP/GARPII complex subunit VPS50; FLJ20097; KIAA1861; mKIAA1861; RGD1304751; syndetin; Vps50; VPS50 EARP/GARPII complex subunit; VPS50, EARP/GARPII complex subunit; VPS54L
• Common Name: CCDC132
• Gene Symbol: Vps50
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QSRSPSVSPSKQPVSTSSKTVTLFEQYCSGGNPFEIQANHKDEETEDVLASNGYESDEQEKSAYQEYDSDSDVPEELKRDYVDEQTGDGPVKSVSRETLKSRKKSDYSLNKVNAP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining