Invitrogen™ Human CCDC12 (aa 94-165) Control Fragment Recombinant Protein

Product Code. 30194091

Brand: Invitrogen™ RP107016

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84460 (PA5-84460. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The exact function of this protein remains unknown.

Specifications

• Accession Number: Q8WUD4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 151903
• Name: Human CCDC12 (aa 94-165) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2700094L05Rik; C76605; CCDC12; coiled-coil domain containing 12; coiled-coil domain-containing protein 12; RGD1306081
• Common Name: CCDC12
• Gene Symbol: CCDC12
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining