Invitrogen™ Human CCDC117 (aa 110-252) Control Fragment Recombinant Protein

Product Code. 30194615

Brand: Invitrogen™ RP91352

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51461 (PA5-51461. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Facilitates DNA repair, cell cycle progression, and cell proliferation through its interaction with CIAO2B.

Specifications

• Accession Number: Q8IWD4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 150275
• Name: Human CCDC117 (aa 110-252) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110004K02Rik; 1700026O03Rik; AU018638; AU042822; AV173073; BC018601; CCDC117; coiled-coil domain containing 117; coiled-coil domain-containing protein 117; dJ366L4.1
• Common Name: CCDC117
• Gene Symbol: CCDC117
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GHGVNPSVSGLSIPGILDVICEEMDQTTGEPQCEVARRKLQEIEDRIIDEDEEVEADRNVNHLPSLVLSDTMKTGLKREFDEVFTKKMIESMSRPSMELVLWKPLPELLSDKPKPSSNTKNYTGESQAKHVAAGTAFPQRTEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining