Invitrogen™ Human CCDC112 (aa 51-148) Control Fragment Recombinant Protein

Product Code. 30203538

Brand: Invitrogen™ RP100202

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60930 (PA5-60930. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CCDC112 (Coiled-Coil Domain Containing 112) is a Protein Coding gene and its exact function is unknown. An important paralog of this gene is CCDC148.

Specifications

• Accession Number: Q8NEF3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 153733
• Name: Human CCDC112 (aa 51-148) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 8430438M01Rik; AW108467; CCDC112; coiled-coil domain containing 112; coiled-coil domain-containing protein 112; MBC1; mutated in bladder cancer 1; mutated in bladder cancer protein 1; RGD1561942
• Common Name: CCDC112
• Gene Symbol: CCDC112
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NVKKLQHQLKDVKPTPDFVEKLREMMEEIENAINTFKEEQRLIYEELIKEEKTTNNELSAISRKIDTWALGNSETEKAFRAISSKVPVDKVTPSTLPE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining