Invitrogen™ Human CCDC104 Control Fragment Recombinant Protein

Product Code. 30212615

Brand: Invitrogen™ RP89857

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52638 (PA5-52638. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The CCDC104 (Coiled-coil domain-containing protein 104) protein, whose function is unknown, is expressed in various human tissues, including the brain, and is localized mainly to the nucleus, but is also found in the cytoplasm. It may act as an effector for ARL3. This protein has 2 isoforms produced by alternative splicing.

Specifications

• Accession Number: Q96G28
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 112942
• Name: Human CCDC104 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2300003H10; 4931428D14Rik; BARTL1; CCDC104; CFAP36; cilia and flagella associated protein 36; cilia- and flagella-associated protein 36; coiled-coil domain containing 104; coiled-coil domain-containing protein 104; RGD1311732; UNQ163/PRO189
• Common Name: CCDC104
• Gene Symbol: CFAP36
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VHSSEAAIMNNSQGDGEHFAHPPSEVKMHFANQSIEPLGRKVERSETSSLPQKGLKIPGLEHASIEGPIANLSVLGTEELRQREHYLKQKRDKLMSMRKDMRTKQIQNMEQKGKPTGE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining