Invitrogen™ Human CCBL1 (aa 340-422) Control Fragment Recombinant Protein

Product Code. 30212986

Brand: Invitrogen™ RP93062

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54341 (PA5-54341. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Kynurenine aminotransferases KAT I, KAT II, and KAT III belong to the class-I pyridoxal-phosphate-dependent aminotransferase family. KAT I is a cytoplasmic protein involved in glutamine catabolism. KAT I functions in the catalysis of the transamination of L-kinurenine to form kynurenic acid, a neuroprotective and anticonvulsant metabolite of tryptophan. Kynurenic acid is involved in synaptic transmission and has been implicated in a number of neurological disorders including schizophrenia and Huntington's disease. KAT I also functions in the metabolism of cysteine conjugates in some halogenated alkenes and alkanes to form reactive metabolites. KAT I has three isoforms. Isoform 1is the full length protein, isoform 2 lacks amino acids 68-117 and isoform 3 lacks amino acids 251-422. Based on sequence similarity, KAT I is thought to function as a homodimer.

Specifications

• Accession Number: Q16773
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 883
• Name: Human CCBL1 (aa 340-422) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010009K05Rik; AI182306; beta-lysase, kidney; CCBL1; cysteine conjugate beta lyase 1; cysteine conjugate-beta lyase 1; cysteine conjugate-beta lyase, cytoplasmic; cysteine conjugate-beta lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase); cysteine-S-conjugate beta-lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase); glutamine transaminase K; glutamine-phenylpyruvate aminotransferase; Glutamine--phenylpyruvate transaminase; Gtk; Kat; KAT1; KATI; KYAT1; kyneurenine aminotransferase; kynurenine aminotransferase 1; Kynurenine aminotransferase I; kynurenine aminotransferase/glutamine transaminase K; kynurenine--oxoglutarate transaminase 1; Kynurenine--oxoglutarate transaminase 1, mitochondrial; kynurenine--oxoglutarate transaminase I
• Common Name: CCBL1
• Gene Symbol: KYAT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining