Invitrogen™ Human CCAR1 (aa 1016-1138) Control Fragment Recombinant Protein

Product Code. 30211427

Brand: Invitrogen™ RP89830

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52473 (PA5-52473. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IFI-44 (interferon-induced protein 44), also known as p44 or MTAP44 (microtubule-associated protein 44), is a 444 amino acid protein that localizes to the cytoplasm and, upon induction by IFN-betas, aggregates to form microtubular structures. Human IFI-44 shares 97% sequence similarity with its chimp counterpart, suggesting a conserved role between species. The gene encoding IFI-44 maps to human chromosome 1, which spans 260 million base pairs, contains over 3,000 genes and comprises nearly 8% of the human genome. Chromosome 1 houses a large number of disease-associated genes, including those that are involved in familial adenomatous polyposis, Stickler syndrome, Parkinson's disease, Gaucher disease, schizophrenia and Usher syndrome.

Specifications

• Accession Number: Q8IX12
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55749
• Name: Human CCAR1 (aa 1016-1138) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610511G16Rik; 9430036H15Rik; Carp1; CARP-1; Ccar1; Cell cycle and apoptosis regulatory protein 1; cell division cycle and apoptosis regulator 1; cell division cycle and apoptosis regulator protein 1; Death inducer with SAP domain; DIS; MGC44628; OTTHUMP00000019709; RGD1560358; RP11-437A18.1
• Common Name: CCAR1
• Gene Symbol: CCAR1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNED
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining