Invitrogen™ Human CC2D2B (aa 98-165) Control Fragment Recombinant Protein

Product Code. 30209913

Brand: Invitrogen™ RP107862

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67224 (PA5-67224. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CC2D2B is a protein coding gene.

Specifications

• Accession Number: Q6DHV5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 387707
• Name: Human CC2D2B (aa 98-165) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: bA248J23.4; C10orf130; C10orf131; CC2D2B; coiled-coil and C2 domain containing 2 B; protein CC2D2B
• Common Name: CC2D2B
• Gene Symbol: CC2D2B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSGEEGSALGKSSEQRPVNRSYPKCFSLGVNLQNVAESEEEEFMKEFILTDILKVKAADYEDDQEQIK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining