missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CC2D1A (aa 175-298) Control Fragment Recombinant Protein

Product Code. 30208933
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208933

Brand: Invitrogen™ RP89205

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52141 (PA5-52141. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a transcriptional repressor that binds to a conserved 14-bp 5'-repressor element and regulates expression of the 5-hydroxytryptamine (serotonin) receptor 1A gene in neuronal cells. The DNA binding and transcriptional repressor activities of the protein are inhibited by calcium. A mutation in this gene results in nonsyndromic mental retardation-3.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6P1N0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54862
Name Human CC2D1A (aa 175-298) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5-HT1A receptor; AKI1; Akt kinase-interacting protein 1; BC016188; CC2D1A; coiled-coil and C2 domain containing 1 A; coiled-coil and C2 domain-containing protein 1 A; Five prime repressor element under dual repression-binding protein 1; five' repressor element under dual repression binding protein 1; five repressor element under dual repression-binding protein 1; FLJ20241; FRE under dual repression-binding protein 1; Freud-1; Freud-1/Aki1; mental retardation, nonsyndromic, autosomal recessive, 3; MRT3; Putative NF-kappa-B-activating protein 023 N; putative NFkB activating protein; RGD1306108; Tape
Common Name CC2D1A
Gene Symbol CC2D1A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSPAPTQPAPRIASAPEPRVTLEGPSATAPASSPGLAKPQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGDTTAAARHFRVAKSFDAVLE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.