missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198854

Invitrogen™ Human CBLC (aa 9-84) Control Fragment Recombinant Protein

Product Code. 30198854
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198854

Brand: Invitrogen™ RP105899

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65144 (PA5-65144. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the Cbl family of E3 ubiquitin ligases. Cbl proteins play important roles in cell signaling through the ubiquitination and subsequent downregulation of tyrosine kinases. Expression of this gene may be restricted to epithelial cells, and alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9ULV8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23624
Name Human CBLC (aa 9-84) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310076I21Rik; 2310079L19Rik; Cas-Br-M (murine) ecotropic retroviral transforming sequence c; Cas-Br-M (murine) ectropic retroviral transforming sequence c; Casitas B-lineage lymphoma c; Cbl proto-oncogene C; Cbl proto-oncogene C, E3 ubiquitin protein ligase; Cbl proto-oncogene, E3 ubiquitin protein ligase C; Cbl3; CBL-3; CBLC; CBL-SL; E3 ubiquitin-protein ligase CBL-C; RING finger protein 57; RING-type E3 ubiquitin transferase CBL-C; RNF57; SH3-binding protein CBL-3; SH3-binding protein CBL-C; signal transduction protein CBL-C
Common Name CBLC
Gene Symbol Cblc
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAHSRRAAGGGGPGGPGGSGDFLLIYL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.