Invitrogen™ Human Cathepsin C (aa 159-221) Control Fragment Recombinant Protein

Product Code. 30204349

Brand: Invitrogen™ RP105398

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66854 (PA5-66854. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cathepsin C, known also as dipeptidyl aminopeptidase I (DPPI), is a tetrameric lysosomal cysteine peptidase belonging to the papain family. Cathepsin C is involved in intracellular protein degradation and the processing of protein precursors, where it participates in cell growth, neuraminidase activation, and platelet factor XIII activation. Cathepsin C is largely related to other lysosomal cysteine proteinases, including cathepsin B, H and L. Enzymatically, Cathepsin C is capable of sequentially removing dipeptides from the amino terminus, and it requires halide ions, namely chloride ions, and thiols for complete enzymatic activity. Protein levels of Cathepsin C are detected in a variety of tissues, and it is most highly expressed in spleen, kidney, cytotoxic lymphocytes and myeloid cells, where it localizes to the secretory granule compartment. Cathepsin C is initially synthesized as a proenzyme that is rapidly processed to generate two distinct chains that function together as the mature form of the enzyme.

Specifications

• Accession Number: P53634
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1075
• Name: Human Cathepsin C (aa 159-221) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI047818; CATC; Cathepsin C; cathepsin J; CPPI; CTSC; Dipeptidyl peptidase 1; Dipeptidyl peptidase 1 exclusion domain chain; Dipeptidyl peptidase 1 heavy chain; Dipeptidyl peptidase 1 light chain; Dipeptidyl peptidase I; Dipeptidyl peptidase I exclusion domain chain; Dipeptidyl peptidase I heavy chain; Dipeptidyl peptidase I light chain; Dipeptidyl transferase; dipeptidyl-peptidase; dipeptidylpeptidase 1; dipeptidyl-peptidase 1; dipeptidyl-peptidase I; DPP1; DPPI; DPP-I; HMS; JP; JPD; PALS; PDON1; PLS
• Common Name: Cathepsin C
• Gene Symbol: CTSC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining