missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203130

Invitrogen™ Human Catenin delta-2 (aa 77-210) Control Fragment Recombinant Protein

Product Code. 30203130
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203130

Brand: Invitrogen™ RP90908

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53275 (PA5-53275. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Armadillo-like proteins are characterized by a series of armadillo repeats, first defined in the Drosophila 'armadillo' gene product, that are typically 42 to 45 amino acids long. These proteins can be divided into subfamilies based on the number of repeats, their overall sequence similarity, and the dispersion of the repeats throughout their sequences. Members of the p120(ctn)/plakophilin subfamily of Armadillo-like proteins, including CTNND1, Catenin delta-2, PKP1, PKP2, PKP4, and ARVCF, have 10 armadillo repeats each (Bonne et al., 1998 [PubMed 9721216]).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UQB3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1501
Name Human Catenin delta-2 (aa 77-210) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias catenin (cadherin associated protein), delta 2; catenin (cadherin-associated protein), delta 2; catenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein); catenin delta 2; catenin delta-2; catenin delta-2; LOW QUALITY PROTEIN: catenin delta-2; Catnd2; Ctnnd2; Delta-catenin; GT24; Neural plakophilin-related ARM-repeat protein; neurojugin; Neurojungin; Nprap; T-cell delta-catenin
Common Name Catenin delta-2
Gene Symbol CTNND2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ASQLERCKLGSETGSMSSMSSAEEQFQWQSQDGQKDIEDELTTGLELVDSCIRSLQESGILDPQDYSTGERPSLLSQSALQLNSKPEGSFQYPASYHSNQTLALGETTPSQLPARGTQARATGQSFSQGTTSRA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.