Invitrogen™ Human Caspase 5 (aa 7-92) Control Fragment Recombinant Protein

Product Code. 30181967

Brand: Invitrogen™ RP98453

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (23%), Rat (23%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111126 (PA5-111126. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Caspases are a family of cysteine proteases that can be divided into the apoptotic and inflammatory caspase subfamilies. Unlike the apoptotic caspases, members of the inflammatory subfamily are generally not involved in cell death but are associated with the immune response to microbial pathogens. Members of this subfamily include caspase-1, -4, -5, and -12. Activation of these caspases results in the cleavage and activation of proinflammatory cytokines such as IL-1-b and IL-18. Caspase-5 can interact with caspase-1; both are constituents of the NALP1 inflammasome, a complex that can trigger the cleavage of pro-IL-1-b. Expression of caspase-5 can be regulated by lipopolysaccharide (LPS) and IFN-gamma.

Specifications

• Accession Number: P51878
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 838
• Name: Human Caspase 5 (aa 7-92) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CASP5; CASP-5; caspase 5; caspase 5, apoptosis-related cysteine peptidase; caspase 5, apoptosis-related cysteine protease; caspase-5; Caspase-5 subunit p10; Caspase-5 subunit p20; ICE(rel)III; ICE(rel)-III; ICEREL-III; ICH3; ICH-3; Protease ICH-3; protease TY; TY protease
• Common Name: Caspase 5
• Gene Symbol: CASP5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VEGVFIFLIEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVKKDNHKKKTVKMLEYLGKDV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining