Invitrogen™ Human Caspase 1 (aa 253-404) Control Fragment Recombinant Protein

Product Code. 30194414

Brand: Invitrogen™ RP101905

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Caspases are a family of cysteine proteases that can be divided into the apoptotic and inflammatory caspase subfamilies. Unlike the apoptotic caspases, members of the inflammatory subfamily are generally not involved in cell death but are associated with the immune response to microbial pathogens. Members of this subfamily include caspase-1, -4, -5, and -12 and can activate proinflammatory cytokines such as IL-1-b and IL-18. Caspase-1 was initially identified as an IL-1-b-converting enzyme; later experiments revealed it to be a mammalian homolog of the C. elegans cell death gene ced-3 whose overexpression can induce apoptosis in fibroblasts.

Specifications

• Accession Number: P29466
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 834
• Name: Human Caspase 1 (aa 253-404) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CASP1; CASP-1; CASP1 nirs variant 1; caspase 1; caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase); Caspase1; caspase-1; Caspase-1 subunit p10; Caspase-1 subunit p20; ICE; IL-1 beta-converting enzyme; IL-1 B converting enzyme; IL1BC; IL-1 BC; IL1BCE; IL1B-convertase; interleukin 1 beta-converting enzyme; interleukin 1, beta, convertase; interleukin 1-B converting enzyme; Interleukin 1 beta converting enzyme; interleukin-1 beta convertase; Interleukin-1 beta-converting enzyme; p45
• Common Name: Caspase 1
• Gene Symbol: CASP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining