Invitrogen™ Human Casc5 (aa 1553-1699) Control Fragment Recombinant Protein

Produktkod. 30198202

Brand: Invitrogen™ RP106240

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65573 (PA5-65573. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Performs two crucial functions during mitosis: it is essential for spindle-assembly checkpoint signaling and for correct chromosome alignment. Required for attachment of the kinetochores to the spindle microtubules. Directly links BUB1 and BUB1B to kinetochores. Part of the MIS12 complex, which may be fundamental for kinetochore formation and proper chromosome segregation during mitosis. Acts in coordination with CENPK to recruit the NDC80 complex to the outer kinetochore.

Specifikationer

• Accession Number: Q8NG31
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57082
• Name: Human Casc5 (aa 1553-1699) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310043D08Rik; 5730505K17Rik; AF15Q14; ALL1-fused gene from chromosome 15q14 protein; Blinkin; blinkin, bub-linking kinetochore protein; Bub-linking kinetochore protein; cancer susceptibility candidate 5; cancer susceptibility candidate gene 5 protein; Cancer/testis antigen 29; CASC5; CT29; D40; hKNL-1; hSpc105; KIAA1570; kinetochore null 1 homolog; kinetochore scaffold 1; Kinetochore-null protein 1; KNL1; MCPH4; microcephaly, primary autosomal recessive 4; PPP1R55; Protein CASC5; Protein D40/AF15q14; protein phosphatase 1, regulatory subunit 55; Rad51; RAD51 homolog; Spc7
• Common Name: CASC5
• Gene Symbol: KNL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DVTKQVIQTHVNAGEAPDPVITSNVPCFHSIKPNLNNLNGKTGEFLAFQTVHLPPLPEQLLELGNKAHNDMHIVQATEIHNINIISSNAKDSRDEENKKSHNGAETTSLPPKTVFKDKVRRCSLGIFLPRLPNKRNCSVTGIDDLEQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining