Invitrogen™ Human Carboxypeptidase A4 (aa 25-141) Control Fragment Recombinant Protein

Product Code. 30211035

Brand: Invitrogen™ RP92710

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54311 (PA5-54311. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Carboxypeptidase A4 is a member of the carboxypeptidase A/B subfamily. Carboxypeptidases are zinc-containing exopeptidases that catalyze the release of carboxy-terminal amino acids, and are synthesized as zymogens that are activated by proteolytic cleavage. This protein could be involved in the histone hyperacetylation pathway. It is imprinted and may be a strong candidate protein for prostate cancer aggressiveness.

Specifications

• Accession Number: Q9UI42
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51200
• Name: Human Carboxypeptidase A4 (aa 25-141) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110019K20Rik; AV009555; Carboxypeptidase A3; carboxypeptidase A4; CPA3; Cpa4; RGD1563619; UNQ694/PRO1339
• Common Name: Carboxypeptidase A4
• Gene Symbol: CPA4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QVLRINVRNGDEISKLSQLVNSNNLKLNFWKSPSSFNRPVDVLVPSVSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQERSSNNFNYGAYHSLEAIYHEMDNIAADFP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining