missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205281

Invitrogen™ Human CAND1 (aa 404-467) Control Fragment Recombinant Protein

Product Code. 30205281
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205281

Brand: Invitrogen™ RP103473

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64066 (PA5-64066. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CAND1 enhances transcription from various types of promoters. It is a regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins. CAND1 prevents neddylation of CUL1 by physically blocking access to the neddylation site. CAND1 disrupts interactions between CUL1 and SKP1A and between CUL1 and F-box proteins.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q86VP6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55832
Name Human CAND1 (aa 404-467) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310038O07Rik; 6330512O03Rik; AI195005; AI846556; CAND1; cullin associated and neddylation disassociated 1; cullin associated and neddylation dissociated 1; cullin-associated and neddylation-dissociated 1; cullin-associated and neddylation-dissociated protein 1; Cullin-associated NEDD8-dissociated protein 1; D10Ertd516e; DKFZp434M1414; fb78a05; FLJ10114; FLJ10929; FLJ38691; FLJ90441; KIAA0829; mKIAA0829; p120 CAND1; TBP interacting protein; TBP-interacting protein; TBP-interacting protein 120 A; TBP-interacting protein of 120 kDa A; TBP-interacting protein TIP120A; TIP120; TIP120 protein; TIP120A; Tp120a; wu:fb78a05; zgc:55729
Common Name CAND1
Gene Symbol CAND1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.