Invitrogen™ Human CAMTA2 (aa 913-1022) Control Fragment Recombinant Protein

Product Code. 30198435

Brand: Invitrogen™ RP108774

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140051 (PA5-140051. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcription activator. May act as tumor suppressor.

Specifications

• Accession Number: O94983
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23125
• Name: Human CAMTA2 (aa 913-1022) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: calmodulin binding transcription activator 2; calmodulin-binding transcription activator 2; Camta2; Kiaa0909; Kiaa0909-hp; mKIAA0909
• Common Name: CAMTA2
• Gene Symbol: CAMTA2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LPPASDDGAAPEDADSPQAVDVIPVDMISLAKQIIEATPERIKREDFVGLPEAGASMRERTGAVGLSETMSWLASYLENVDHFPSSTPPSELPFERGRLAVPSAPSWAEF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining