Invitrogen™ Human CaMKIV (aa 365-466) Control Fragment Recombinant Protein

Artikelnummer. 30198695

missing translation for 'mfr': Invitrogen™ RP89793

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CAMK4 (CaMKIV) is a serine/threonine protein kinase that phosphoryates CREB, oncoprotein 18, and SRF. It has limited tissue distribution, and has been implicated in transcriptional regulation in lymphocytes, neurons and male germ cells. The nuclear localization of this protein is consistent with its role in mediating calcium-dependent gene expression. CaMKIV is particularly abundant in testis, T-cells, and neurons but is also found in other tissues to varying degrees. In neurons, CaMKIV is thought to play an important role in synaptic plasticity via its gene regulatory effects. In T-cells, this protein plays an important role in calcium signaling which could affect the transcription regulatory protein, nuclear factor of activated T-cells (NFAT). CaMKIV is encoded, along with calspermin, by the CaMKIV gene. It has been found that, in testes, CaMKIV is expressed in germ cells and found to be associated with chromatin. The association of CaMKIV with chromatin suggests a potential role in chromatin remodeling during nuclear condensation in spermatids.

Spezifikation

• Accession Number: Q16566
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 814
• Name: Human CaMKIV (aa 365-466) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A430110E23Rik; AI666733; brain Ca(2+)-calmodulin-dependent protein kinase type IV; brain Ca++-calmodulin-dependent protein kinase type IV; Ca2+/calmodulin-dependent protein kinase type IV/Gr; Calcium/calmoduli; calcium/calmodulin dependent protein kinase IV; calcium/calmodulin-dependent protein kinase IV; calcium/calmodulin-dependent protein kinase IV L homeolog; calcium/calmodulin-dependent protein kinase type IV; calcium/calmodulin-dependent protein kinase type IV catalytic chain; Calmodulin-dependent protein kinase IV; calspermin; CAM kinase- GR; CAM kinase IV; CAM kinase-GR; CAMK; CaMK IV; camk4; camk4.L; camk4-A; CAMK-GR; CAMKIV; CaMKIV/Gr; Ccdpk; D18Bwg0362e; EC 2.7.11.17; KCC4; kinase CaMK4; OTTHUMP00000222818; RATCCDPK; xCaM; XELAEV_18008011mg
• Common Name: CaMKIV
• Gene Symbol: CAMK4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining