Invitrogen™ Human CaMKII gamma Control Fragment Recombinant Protein

Product Code. 30203876

Brand: Invitrogen™ RP104723

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65276 (PA5-65276. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calcium/calmodulin-dependent protein kinase that functions autonomously after Ca(2+)/calmodulin-binding and autophosphorylation, and is involved in dendritic spine and synapse formation, neuronal plasticity and regulation of sarcoplasmic reticulum Ca(2+) transport in skeletal muscle. In neurons, plays an essential structural role in the reorganization of the actin cytoskeleton during plasticity by binding and bundling actin filaments in a kinase-independent manner. This structural function is required for correct targeting of CaMK2A, which acts downstream of NMDAR to promote dendritic spine and synapse formation and maintain synaptic plasticity which enables long-term potentiation (LTP) and hippocampus-dependent learning. In developing hippocampal neurons, promotes arborization of the dendritic tree and in mature neurons, promotes dendritic remodeling. Participates in the modulation of skeletal muscle function in response to exercise. In slow-twitch muscles, is involved in regulation of sarcoplasmic reticulum (SR) Ca(2+) transport and in fast-twitch muscle participates in the control of Ca(2+) release from the SR through phosphorylation of triadin, a ryanodine receptor-coupling factor, and phospholamban (PLN/PLB), an endogenous inhibitor of SERCA2A/ATP2A2.

Specifications

• Accession Number: Q13555
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 818
• Name: Human CaMKII gamma Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Ca2+/calmodulin-dependent protein kinase II; calcium/calmodulin dependent protein kinase II gamma; calcium/calmodulin-dependent protein kinase (CaM kinase) II gamma; calcium/calmodulin-dependent protein kinase II gamma; calcium/calmodulin-dependent protein kinase type II gamma chain; calcium/calmodulin-dependent protein kinase type II subunit gamma; CaM kinase II subunit gamma; CAM2; CAMK; CaMK II; CAMK2; CAMK2B; CAMK2D; Camk2g; CAMKB; CAMKD; CAMKG; CAMK-II; caMK-II subunit gamma; caM-kinase II gamma chain
• Common Name: CaMKII gamma
• Gene Symbol: CAMK2G
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NSLVSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining