Invitrogen™ Human Calsequestrin 2 (aa 20-84) Control Fragment Recombinant Protein

Product Code. 30205997

Brand: Invitrogen™ RP94140

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55568 (PA5-55568. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calsequestrin (CASQ) is a Ca2+-binding protein present primarily in junctional sarcoplasmic reticulum of skeletal and cardiac muscle; the cardiac form (CASQ2) is encoded by a separate gene. The primary role of CASQ2 is buffering of the sarcoplasmic reticulum Ca2+ ions, but another role for CASQ2 has emerged recently: CASQ2 regulates the open probability of ryanodine receptor 2 (RyR2). Mutations in CASQ2 cause stress-induced polymorphic ventricular tachycardia, also referred to as catecholaminergic polymorphic ventricular tachycardia 2 (CPVT2), a disease characterized by bidirectional ventricular tachycardia that may lead to cardiac arrest.

Specifications

• Accession Number: O14958
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 845
• Name: Human Calsequestrin 2 (aa 20-84) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA033488; AW146219; calsequestrin; calsequestrin 2; calsequestrin 2 (cardiac muscle); calsequestrin 2, fast-twitch, cardiac muscle; calsequestrin, cardiac muscle isoform; Calsequestrin-2; cardCSQ; cardiac calsequestrin; CASQ2; cCSQ; Csq2; ESTM52; LOW QUALITY PROTEIN: calsequestrin-2; PDIB2; SR calcium binding protein
• Common Name: Calsequestrin 2
• Gene Symbol: Casq2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining