Invitrogen™ Human CALCRL (aa 29-138) Control Fragment Recombinant Protein

Product Code. 30201429

Brand: Invitrogen™ RP89622

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52511 (PA5-52511. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CRLR is a receptor for calcitonin gene-related peptide type 1. The activity of CRLR is mediated by G proteins which activate adenylyl cyclase. CRLR expression has been reported in brain, lung, blood vessel, liver, and intestinal tract. ESTs have been isolated from B-cell/lung/testis, bome marrow, embryo, lung and synovium libraries.

Specifications

• Accession Number: Q16602
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10203
• Name: Human CALCRL (aa 29-138) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AV071593; Calcitonin gene-related peptide type 1 receptor; calcitonin receptor like receptor; calcitonin receptor-like; calcitonin receptor-like receptor; CALCRL; CGRP receptor; CGRP type 1 receptor; Cgrp1 receptor; CGRPR; CLR; CRLR; RATCRLR; RNCLR
• Common Name: CALCRL
• Gene Symbol: CALCRL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining