Invitrogen™ Human CADM3 (aa 84-225) Control Fragment Recombinant Protein

Product Code. 30209403

Brand: Invitrogen™ RP94790

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82047 (PA5-82047. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IGSF4B is a brain-specific protein related to the calcium-independent cell-cell adhesion molecules known as nectins.

Specifications

• Accession Number: Q8N126
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57863
• Name: Human CADM3 (aa 84-225) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BIgR; brain immunoglobulin receptor; CADM3; Cell adhesion molecule 3; dendritic cell nectin-like protein 1 short isoform; IGSF4B; Immunoglobulin superfamily member 4 B; immunoglobulin superfamily, member 4 B; NECL1; NECL-1; nectin-like 1; nectin-like protein 1; nectin-lke 1; synaptic cell adhesion molecule 3; SYNCAM3; TSLC1-like 1; TSLC1-like protein 1; TSLL1; UNQ225/PRO258
• Common Name: CADM3
• Gene Symbol: Cadm3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining