Invitrogen™ Human CACNA1F (aa 1813-1889) Control Fragment Recombinant Protein

Product Code. 30205912

Brand: Invitrogen™ RP108540

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84778 (PA5-84778. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1F gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, benzothiazepines, and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to omega-conotoxin-GVIA (omega-CTx-GVIA) and omega-agatoxin-IVA (omega-Aga-IVA).

Specifications

• Accession Number: O60840
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 778
• Name: Human CACNA1F (aa 1813-1889) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A930034B14; AIED; Cacna1f; CACNAF1; calcium channel, voltage-dependent, alpha 1 F subunit; calcium channel, voltage-dependent, L type, alpha 1 F subunit; calcium voltage-gated channel subunit alpha1 F; Cav1.4; Cav1.4 alpha1; COD3; COD4; CORDX; CORD x 3; CSNB2; CSNB2A; CSNB x 2; JM8; JMC8; L-type dihydropyridine-sensitive calcium channel alpha-1 f subunit; nerg1; nob2; OA2; Sfc17; Voltage-dependent L-type calcium channel subunit alpha-1 F; voltage-gated calcium channel subunit alpha Cav1.4
• Common Name: CACNA1F
• Gene Symbol: CACNA1F
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SCEDLPIPGTYHRGRNSGPNRAQGSWATPPQRGRLLYAPLLLVEEGAAGEGYLGRSSGPLRTFTCLHVPGTHSDPSH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining