Invitrogen™ Human CACHD1 (aa 454-585) Control Fragment Recombinant Protein

Product Code. 30194343

Brand: Invitrogen™ RP90353

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53561 (PA5-53561. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CACHD1 is a protein coding gene.

Specifications

• Accession Number: Q5VU97
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57685
• Name: Human CACHD1 (aa 454-585) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1190007F10Rik; AI852726; B430218L07Rik; cachd1; cache domain containing 1; cache domain-containing protein 1; KIAA1573; mKIAA1573; RGD1310770; von Willebrand factor type A and cache domain containing 1; Vwcd1; VWFA and cache domain-containing protein 1
• Common Name: CACHD1
• Gene Symbol: CACHD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLPFSDEMGDGLIMTVSKPCYFGNLLLGIVGVDVNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLTRPYLLSEPPLHTDIIHYENIPKFELVRQNILSLPLGSQIIAVPVNSSLSWHINKLRETGKEA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining