Invitrogen™ Human CABYR (aa 181-273) Control Fragment Recombinant Protein

Product Code. 30182394

Brand: Invitrogen™ RP98250

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59256 (PA5-59256. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Spermatozoa gain fertilization capacitation and hyperactivation after residing in the uterus or oviduct. Calcium, cAMP and protein tyrosine phosphorylation are necessary for the molecular mechanisms that allow for this transformation. CABYR (Calcium-binding tyrosine phosphorylation-regulated protein), also known as Fibrousheathin-2 or Cancer/testis antigen 88, is a 493 amino acid protein that is expressed in sperm flagella and exhibits increased tyrosine phosphorylation during capacitation. There are six named isoforms of CABYR that are produced as a result of alternative slicing events. Specifically, isoform 1 is expressed in the testis, while isoform 3 and isoform 5 are expressed in pancreas, brain and various brain tumors. Isoforms 1, 2 and 6 most likely bind calcium, whereas isoforms 3, 4 and 5 probably do not bind calcium.

Specifications

• Accession Number: O75952
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26256
• Name: Human CABYR (aa 181-273) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700016C01Rik; 4933421A18Rik; Cabyr; CABYRa; CABYRc; CABYRc/d; CABYRe; calcium binding tyrosine phosphorylation regulated; calcium binding tyrosine-(Y)-phosphorylation regulated; calcium binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2); calcium-binding protein 86; Calcium-binding tyrosine phosphorylation-regulated protein; calcium-binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2); calcium-binding tyrosine-phosphorylation regulated protein; cancer/testis antigen 88; CBP86; CT88; fibrousheathin 2; fibrousheathin II; Fibrousheathin-2; FSP2; FSP-2; testis tissue sperm-binding protein Li 84 P; testis-specific calcium-binding protein CBP86
• Common Name: CABYR
• Gene Symbol: CABYR
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GKVSSIHSDQSDVLMVDVATSMPVVIKEVPSSEAAEDVMVAAPLVCSGKVLEVQVVNQTSVHVDLGSQPKENEAEPSTASSVPLQDEQEPPAY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining