Invitrogen™ Human CABCOCO1 (aa 135-203) Control Fragment Recombinant Protein

Product Code. 30202678

Brand: Invitrogen™ RP97194

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59550 (PA5-59550. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CABCOCO1 (C10orf107) is a calcium-binding protein that may be involved in the control of sperm flagellar movement.

Specifications

• Accession Number: Q8IVU9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 219621
• Name: Human CABCOCO1 (aa 135-203) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: bA63A2.1; C10orf107; CABCOCO1; chromosome 10 open reading frame 107; Ciliary-associated calcium-binding coiled-coil protein 1; RGD1306739; similar to RIKEN cDNA 1700040L02; uncharacterized protein C10orf107; uncharacterized protein C10orf107 homolog
• Common Name: CABCOCO1
• Gene Symbol: CABCOCO1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EMKRLDQEQGPEESQPETDTSDMDPLVGFTIEDVKSVLDQVTDDILIGIQTEINEKLQIQEEAFNARIE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining