Invitrogen™ Human C9orf72 (aa 110-199) Control Fragment Recombinant Protein

Product Code. 30209930

Brand: Invitrogen™ RP92992

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54905 (PA5-54905. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C9orf72 may play a role in endosomal trafficking and autophagy. It is known to interact with HNRNPA1, HNRNPA2B1, UBQLN2, and small Rab GTPSases. C9orf72 localizes in the nucleus, cytoplasm, endosome, lysosome, and autophagosome. Mutations in this gene can result in frontotemporal dementia and/or amyotrophic lateral sclerosis.

Specifications

• Accession Number: Q96LT7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 203228
• Name: Human C9orf72 (aa 110-199) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110043O21Rik; AI840585; ALSFTD; C9orf72; chromosome 9 open reading frame 72; FTDALS; FTDALS1; Guanine nucleotide exchange C9orf72; Guanine nucleotide exchange C9orf72 homolog; protein C9orf72; protein C9orf72 homolog; RGD1359108; RIKEN cDNA 3110043O21 gene; similar to RIKEN cDNA 3110043O21
• Common Name: C9orf72
• Gene Symbol: C9orf72
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining