Invitrogen™ Human C9orf117 (aa 159-255) Control Fragment Recombinant Protein

Product Code. 30206359

Brand: Invitrogen™ RP93025

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54420 (PA5-54420. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifically required during spermatogenesis for flagellum morphogenesis and sperm motility. May be required to suppress the formation of supernumerary axonemes and ensure a correct ultrastructure.

Specifications

• Accession Number: Q5JU67
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 286207
• Name: Human C9orf117 (aa 159-255) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700019L03Rik; C25H9orf117; C9H9orf117; C9orf117; Cfap157; cilia and flagella associated protein 157; cilia- and flagella-associated protein 157; LOC499781; LOW QUALITY PROTEIN: uncharacterized protein C9orf117 homolog; RIKEN cDNA 1700019L03 gene; similar to CG17122-PA; uncharacterized protein C9orf117; uncharacterized protein C9orf117 homolog
• Common Name: C9orf117
• Gene Symbol: CFAP157
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EEVTDKFTLLEEQVRKQENEFRDYAYNLEKKSVLDKDRLRKEIIQRVNLVANEFHKVTTNRMWETTKRAIKENNGITLQMARVSQQGMKLLQENEQL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining